view_context: Dynamic page
Embracing Difference: The Hundred Dresses and Garvey's Choice
Students explore acceptance of themselves and others in order to start discussions about bullying, tolerance, acceptance, and forgiveness, and focus on identifying the central message in a longer text.
ELA
Unit 5
3rd Grade
Unit Summary
In this unit, students read the core texts The Hundred Dresses and Garvey’s Choice as a way of exploring what it means to be accepting and tolerant of themselves and others. The Hundred Dresses challenges students to think about the different roles associated with bullying through the eyes of the narrator, who struggles with her own involvement with a classmate who is bullied. Garvey’s Choice illustrates the way others influence the way we see ourselves, both positively and negatively, and the power of accepting ourselves by tracing Garvey's path to self-discovery and acceptance. Both texts are full of moments and messages that are easily relatable for students at this grade level. Therefore, it is our hope that the experiences of the characters in both texts serve as a neutral launching point for deeper discussions about bullying, tolerance, acceptance, and forgiveness.
The main focus of the unit is on identifying and tracing the central message across a longer text. Students develop a deep understanding of each character's thoughts, feelings, and motivations, which helps them identify and explain how the central message is developed and conveyed through the characters in each text. Students also begin to understand how successive parts of a text build on each other to push the plot forward. Particularly with Garvey’s Choice, students analyze the genre features of novels written in verse and how each part helps build and develop the central message.
When discussing the text, students continue to work on engaging with the thinking of others by building on, paraphrasing, questioning, and clarifying ideas to understand. At this point in the sequence, students are able to write fluently in response to the daily Target Tasks to show understanding of the text. In this unit, students return to working on writing strong literary analysis and opinion paragraphs, building on work done in previous units on topic sentences, supporting details, and strategies for elaboration. Students also write a narrative in verse, reinforcing the narrative writing work done in previous units.
Please Note: In January 2026, this unit and its lesson plans received a round of enhancements. Writing projects throughout the unit have been adjusted, as have the end-of-unit assessments. This unit is now 37 instructional days (previously 35 days). Teachers should pay close attention as they intellectually prepare to account for the updated pacing, sequencing, and content.
Fishtank Plus for ELA
Unlock features to optimize your prep time, plan engaging lessons, and monitor student progress.
Texts and Materials
Some of the links in the sections below are Bookshop affiliate links. This means that if you click and make a purchase, we receive a small portion of the proceeds, which supports our non-profit mission.
Core Texts
-
Book: The Hundred Dresses by Eleanor Estes (HMH Books for Young Readers, 2004) — 870L
-
Book: Garvey's Choice by Nikki Grimes (WordSong, 2016) — 620L
Supporting Texts
Rubrics
Resources for Lessons and Projects
Assessment
The following assessments accompany Unit 5. For more guidance, see the Summative Assessments and Assessments Accommodations & Modifications Teacher Tools.
Content Assessment
The Content Assessment measures students' understanding of the unit's content knowledge and vocabulary. It should serve as the primary assessment for the unit.
Cold Read Assessment
The Cold Read Assessment tests students' ability to comprehend a "cold" or unfamiliar passage and answer standards-based questions. The Cold Read Assessment can be given in addition to the Content Assessment as a pulse point for what students can read and analyze independently, a skill often required for standardized testing.
Fluency Assessment
The Fluency Assessment measures students' oral reading fluency with a passage drawn from one of the unit's core texts. See the Assessing Reading Fluency Teacher Tool for more guidance.
Unit Prep
Intellectual Prep
Before you teach this unit, unpack the texts, themes, and core standards through our guided intellectual preparation process. Each Unit Launch includes a series of short videos, targeted readings, and opportunities for action planning to ensure you're prepared to support every student.
Essential Questions
- What different roles do people play in bullying?
- What does it mean to be accepting of ourselves?
- What does it mean to be accepting of others?
Reading Focus Areas
-
Stories in prose use predictable structures to help readers understand the story.
-
Stories written in verse use predictable structures to help readers understand the story.
-
Character relationships can directly impact the sequence of events and development of the central message.
Writing Focus Areas
Narrative Writing
-
Use relevant text details or background knowledge from the text to develop characters, ideas, or situations.
-
Write a sequence of events that unfolds naturally.
-
Use precise words and phrases to develop events and experiences.
Opinion Writing
-
Write a topic sentence that clearly states an opinion.
-
Provide reasons that support an opinion.
-
Use linking words and phrases to connect reasons with evidence.
-
Include a concluding statement.
Speaking and Listening Focus Areas
-
Build on a partner's ideas. Seek to genuinely understand what their peers are saying, and then build on.
-
Paraphrase to make meaning. Paraphrase what others are saying in order to keep track of key ideas in a discussion.
-
Question and clarify. Seek to clarify a particular point a student makes by asking follow-up questions.
Vocabulary
Text-based
absentmindedlycasualnesscowardconsoleddeliberatelydisgracefullyexquisiteforbiddingimpulsivelyinseparableincredulouslylavishmockrelievedself-imageswiftlytimidunintelligiblevividly
Root/Affix
-ful-ly-nessdis-en-in-un-
To see all the vocabulary for Unit 5, view our 3rd Grade Vocabulary Glossary.
Supporting All Students
In order to ensure that all students are able to access the texts and tasks in this unit, it is incredibly important to intellectually prepare to teach the unit prior to launching the unit. Use the intellectual preparation protocol and the Unit Launch to determine which support students will need. To learn more, visit the Supporting All Students Teacher Tool.
Lesson Map
Write an opinion letter to your future 4th grade self that shows what you believe about bullying and how you will take action to prevent it.
Brainstorm and plan an opinion letter by identifying what students believe about bullying, why it is wrong, and how they can take action to prevent it.
- Taking a Stand Against Bullying Brainstorm (G3, U5, L18)
- Taking a Stand Against Bullying Brainstorm Sample (G3, U5, L18)
- Two Paragraph Outline
- Two Paragraph Outline Sample (G3, U5, L18)
Standards
W.3.1W.3.1.aW.3.1.bW.3.1.cW.3.1.dW.3.4W.3.5
Draft both paragraphs of their opinion letter, explaining their belief about bullying and describing specific actions they will take to prevent it.
- Two Paragraph Outline — Completed from Day 1
Standards
W.3.1W.3.1.aW.3.1.bW.3.1.cW.3.1.dW.3.4W.3.5
Revise an opinion paragraph by choosing the most appropriate revision strategies to make writing more convincing.
- Revision Strategy Menu 1 (G3, U5, L18)
- Revision Practice Handout (G3, U5, L18)
Standards
W.3.1W.3.4W.3.5
Incorporate revisions, write their final copies, and address letters.
Standards
W.3.1W.3.4W.3.5
Write a realistic fiction narrative in verse that shows a character's journey toward loving and accepting who they are, using a series of three to six free-verse poems.
Brainstorm ideas for a narrative in verse by exploring characters who may struggle to love who they are, and identify possible wishes, challenges, and moments of growth that can shape their poem series.
- Detail Cards (G3, U5, L30)
- Character Brainstorm (G3, U5, L30)
Standards
RL.3.3RL.3.5W.3.3
Plan a realistic fiction narrative that shows a character's journey toward loving and accepting who they are.
- Story Mountain Graphic Organizer (G3)
Standards
RL.3.3RL.3.5W.3.3W.3.5
Draft a realistic fiction narrative in verse that shows a character's journey toward loving and accepting who they are.
Standards
L.3.5RL.3.3RL.3.5W.3.3
Revise a narrative poem by choosing strategies that refine line breaks, specific details, and the emotional heart of the moment.
- Revision Strategy Menu 2 (G3, U5, L30)
Standards
L.3.1.aL.3.2.dRL.3.5W.3.3W.3.5
Publish a series of free-verse poems that explore a character who struggles to love who they are.
Standards
RL.3.7W.3.3W.3.4W.3.5